Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  6. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  7. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  8. Avatar for Deleted group 19. Deleted group pts. 8,608
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539

  1. Avatar for Soggy Doglog 81. Soggy Doglog Lv 1 17 pts. 9,760
  2. Avatar for t012 82. t012 Lv 1 17 pts. 9,760
  3. Avatar for Deleted player 83. Deleted player pts. 9,754
  4. Avatar for cbwest 84. cbwest Lv 1 16 pts. 9,753
  5. Avatar for Mike Cassidy 85. Mike Cassidy Lv 1 15 pts. 9,737
  6. Avatar for Truncheon Luncheon 86. Truncheon Luncheon Lv 1 15 pts. 9,736
  7. Avatar for Paulo Roque 87. Paulo Roque Lv 1 15 pts. 9,727
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 14 pts. 9,717
  9. Avatar for Bushman 89. Bushman Lv 1 14 pts. 9,692
  10. Avatar for ecali 90. ecali Lv 1 14 pts. 9,691

Comments