Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,241
  2. Avatar for Void Crushers 2. Void Crushers 78 pts. 10,232
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,209
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,205
  5. Avatar for Go Science 5. Go Science 33 pts. 10,197
  6. Avatar for Contenders 6. Contenders 24 pts. 10,141
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 10,124
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 10,097
  9. Avatar for Deleted group 9. Deleted group pts. 10,066
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 10,022
  1. Avatar for Soggy Doglog 81. Soggy Doglog Lv 1 17 pts. 9,760
  2. Avatar for t012 82. t012 Lv 1 17 pts. 9,760
  3. Avatar for Deleted player 83. Deleted player pts. 9,754
  4. Avatar for cbwest 84. cbwest Lv 1 16 pts. 9,753
  5. Avatar for Mike Cassidy 85. Mike Cassidy Lv 1 15 pts. 9,737
  6. Avatar for Truncheon Luncheon 86. Truncheon Luncheon Lv 1 15 pts. 9,736
  7. Avatar for Paulo Roque 87. Paulo Roque Lv 1 15 pts. 9,727
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 14 pts. 9,717
  9. Avatar for Bushman 89. Bushman Lv 1 14 pts. 9,692
  10. Avatar for ecali 90. ecali Lv 1 14 pts. 9,691

Comments