Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 7,308
  1. Avatar for kitek314_pl 101. kitek314_pl Lv 1 10 pts. 9,540
  2. Avatar for SKSbell 102. SKSbell Lv 1 10 pts. 9,530
  3. Avatar for brgreening 103. brgreening Lv 1 9 pts. 9,506
  4. Avatar for Mohambone 104. Mohambone Lv 1 9 pts. 9,503
  5. Avatar for MaartenDesnouck 105. MaartenDesnouck Lv 1 9 pts. 9,503
  6. Avatar for tarimo 106. tarimo Lv 1 9 pts. 9,495
  7. Avatar for WBarme1234 107. WBarme1234 Lv 1 8 pts. 9,487
  8. Avatar for agnairt 108. agnairt Lv 1 8 pts. 9,428
  9. Avatar for proteansoup 109. proteansoup Lv 1 8 pts. 9,403
  10. Avatar for Merf 110. Merf Lv 1 8 pts. 9,388

Comments