Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 7,308

  1. Avatar for weurhartdezirez 151. weurhartdezirez Lv 1 2 pts. 8,910
  2. Avatar for drumpeter18yrs9yrs 152. drumpeter18yrs9yrs Lv 1 2 pts. 8,900
  3. Avatar for NotJim99 153. NotJim99 Lv 1 2 pts. 8,883
  4. Avatar for ChinaSESsolve 154. ChinaSESsolve Lv 1 2 pts. 8,874
  5. Avatar for fryguy 155. fryguy Lv 1 2 pts. 8,869
  6. Avatar for Czim 156. Czim Lv 1 2 pts. 8,869
  7. Avatar for senor pit 157. senor pit Lv 1 2 pts. 8,865
  8. Avatar for leehaggis 158. leehaggis Lv 1 2 pts. 8,850
  9. Avatar for jchack10 159. jchack10 Lv 1 2 pts. 8,844
  10. Avatar for isantheautumn 160. isantheautumn Lv 1 2 pts. 8,832

Comments