Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 7,308

  1. Avatar for gitwut 21. gitwut Lv 1 68 pts. 10,141
  2. Avatar for nemo7731 22. nemo7731 Lv 1 67 pts. 10,139
  3. Avatar for Norrjane 23. Norrjane Lv 1 65 pts. 10,134
  4. Avatar for LociOiling 24. LociOiling Lv 1 64 pts. 10,134
  5. Avatar for Vredeman 25. Vredeman Lv 1 63 pts. 10,126
  6. Avatar for Museka 26. Museka Lv 1 62 pts. 10,124
  7. Avatar for mirp 27. mirp Lv 1 60 pts. 10,122
  8. Avatar for sheerbliss 28. sheerbliss Lv 1 59 pts. 10,120
  9. Avatar for nicobul 29. nicobul Lv 1 58 pts. 10,113
  10. Avatar for diamond_dust 30. diamond_dust Lv 1 57 pts. 10,111

Comments