Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 7,308

  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 45 pts. 10,066
  2. Avatar for Bletchley Park 42. Bletchley Park Lv 1 44 pts. 10,053
  3. Avatar for deLaCeiba 43. deLaCeiba Lv 1 43 pts. 10,022
  4. Avatar for hpaege 44. hpaege Lv 1 42 pts. 10,017
  5. Avatar for joremen 45. joremen Lv 1 41 pts. 10,013
  6. Avatar for Mark- 46. Mark- Lv 1 40 pts. 10,006
  7. Avatar for crpainter 47. crpainter Lv 1 39 pts. 9,989
  8. Avatar for silverberg 48. silverberg Lv 1 38 pts. 9,984
  9. Avatar for aznarog 49. aznarog Lv 1 37 pts. 9,977
  10. Avatar for manu8170 50. manu8170 Lv 1 37 pts. 9,972

Comments