Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 7,308

  1. Avatar for hansvandenhof 51. hansvandenhof Lv 1 36 pts. 9,957
  2. Avatar for stomjoh 52. stomjoh Lv 1 35 pts. 9,955
  3. Avatar for isaksson 53. isaksson Lv 1 34 pts. 9,939
  4. Avatar for Glen B 54. Glen B Lv 1 33 pts. 9,931
  5. Avatar for strong_base 55. strong_base Lv 1 33 pts. 9,928
  6. Avatar for WarpSpeed 56. WarpSpeed Lv 1 32 pts. 9,908
  7. Avatar for jobo0502 57. jobo0502 Lv 1 31 pts. 9,908
  8. Avatar for greepski 58. greepski Lv 1 30 pts. 9,906
  9. Avatar for shettler 59. shettler Lv 1 30 pts. 9,888
  10. Avatar for caglar 60. caglar Lv 1 29 pts. 9,886

Comments