Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 7,308
  1. Avatar for lynnai 61. lynnai Lv 1 28 pts. 9,884
  2. Avatar for Crossed Sticks 62. Crossed Sticks Lv 1 28 pts. 9,871
  3. Avatar for alwen 63. alwen Lv 1 27 pts. 9,868
  4. Avatar for BrKapr 64. BrKapr Lv 1 26 pts. 9,868
  5. Avatar for weitzen 65. weitzen Lv 1 26 pts. 9,856
  6. Avatar for Pro Lapser 66. Pro Lapser Lv 1 25 pts. 9,855
  7. Avatar for jamiexq 67. jamiexq Lv 1 25 pts. 9,846
  8. Avatar for egran48 68. egran48 Lv 1 24 pts. 9,842
  9. Avatar for Colostomy EXPLOSION. 69. Colostomy EXPLOSION. Lv 1 23 pts. 9,834
  10. Avatar for Idiotboy 70. Idiotboy Lv 1 23 pts. 9,833

Comments