Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for mirjamvandelft 131. mirjamvandelft Lv 1 1 pt. 8,170
  2. Avatar for demeter900 132. demeter900 Lv 1 1 pt. 8,166
  3. Avatar for Sydefecks 133. Sydefecks Lv 1 1 pt. 8,157
  4. Avatar for franse 134. franse Lv 1 1 pt. 8,136
  5. Avatar for firejuggler 135. firejuggler Lv 1 1 pt. 8,101
  6. Avatar for zo3xiaJonWeinberg 136. zo3xiaJonWeinberg Lv 1 1 pt. 8,086
  7. Avatar for Jaco van As 137. Jaco van As Lv 1 1 pt. 8,053
  8. Avatar for tela 138. tela Lv 1 1 pt. 8,043
  9. Avatar for dbuske 139. dbuske Lv 1 1 pt. 8,042
  10. Avatar for brgreening 140. brgreening Lv 1 1 pt. 7,998

Comments