Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for dahast.de 141. dahast.de Lv 1 1 pt. 7,983
  2. Avatar for bwkittitas 142. bwkittitas Lv 1 1 pt. 7,975
  3. Avatar for yoosm2005 143. yoosm2005 Lv 1 1 pt. 7,929
  4. Avatar for Maru67 144. Maru67 Lv 1 1 pt. 7,901
  5. Avatar for Dantoto 145. Dantoto Lv 1 1 pt. 7,895
  6. Avatar for Savas 146. Savas Lv 1 1 pt. 7,891
  7. Avatar for lamoille 147. lamoille Lv 1 1 pt. 7,875
  8. Avatar for parsnip 148. parsnip Lv 1 1 pt. 7,873
  9. Avatar for HorribleIgor 149. HorribleIgor Lv 1 1 pt. 7,863
  10. Avatar for kerpowah 150. kerpowah Lv 1 1 pt. 7,836

Comments