Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for jebbiek 171. jebbiek Lv 1 1 pt. 6,887
  2. Avatar for momadoc 172. momadoc Lv 1 1 pt. 6,867
  3. Avatar for asperger1993 173. asperger1993 Lv 1 1 pt. 6,863
  4. Avatar for blinkomania 174. blinkomania Lv 1 1 pt. 6,828
  5. Avatar for pandapharmd 175. pandapharmd Lv 1 1 pt. 6,826
  6. Avatar for TD06 176. TD06 Lv 1 1 pt. 6,820
  7. Avatar for val.sch67 177. val.sch67 Lv 1 1 pt. 6,724
  8. Avatar for Kokosko 178. Kokosko Lv 1 1 pt. 6,644
  9. Avatar for Hutty 179. Hutty Lv 1 1 pt. 6,470
  10. Avatar for KaienY 180. KaienY Lv 1 1 pt. 6,217

Comments