Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057

  1. Avatar for BCAA 181. BCAA Lv 1 1 pt. 6,149
  2. Avatar for marie.c 182. marie.c Lv 1 1 pt. 6,119
  3. Avatar for smarthuman 183. smarthuman Lv 1 1 pt. 6,089
  4. Avatar for ephilipsvt 184. ephilipsvt Lv 1 1 pt. 6,014
  5. Avatar for Deleted player 185. Deleted player pts. 5,852
  6. Avatar for Close At Hand 186. Close At Hand Lv 1 1 pt. 5,661
  7. Avatar for AryehK 187. AryehK Lv 1 1 pt. 5,645
  8. Avatar for phatvo2000vn 188. phatvo2000vn Lv 1 1 pt. 5,642
  9. Avatar for MaartenDesnouck 189. MaartenDesnouck Lv 1 1 pt. 5,640
  10. Avatar for zejerman 190. zejerman Lv 1 1 pt. 5,303

Comments