Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for KarenCH 21. KarenCH Lv 1 60 pts. 9,260
  2. Avatar for mimi 22. mimi Lv 1 59 pts. 9,258
  3. Avatar for mirp 23. mirp Lv 1 57 pts. 9,256
  4. Avatar for steveB 24. steveB Lv 1 55 pts. 9,246
  5. Avatar for weitzen 25. weitzen Lv 1 54 pts. 9,238
  6. Avatar for LociOiling 26. LociOiling Lv 1 53 pts. 9,228
  7. Avatar for justjustin 27. justjustin Lv 1 51 pts. 9,221
  8. Avatar for crpainter 28. crpainter Lv 1 50 pts. 9,213
  9. Avatar for jermainiac 29. jermainiac Lv 1 48 pts. 9,211
  10. Avatar for diamond_dust 30. diamond_dust Lv 1 47 pts. 9,193

Comments