Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for Madde 41. Madde Lv 1 34 pts. 9,146
  2. Avatar for alwen 42. alwen Lv 1 33 pts. 9,146
  3. Avatar for grogar7 43. grogar7 Lv 1 32 pts. 9,141
  4. Avatar for Crossed Sticks 44. Crossed Sticks Lv 1 31 pts. 9,126
  5. Avatar for isaksson 45. isaksson Lv 1 30 pts. 9,112
  6. Avatar for gcm24 46. gcm24 Lv 1 29 pts. 9,109
  7. Avatar for tony46 47. tony46 Lv 1 28 pts. 9,099
  8. Avatar for nicobul 48. nicobul Lv 1 27 pts. 9,086
  9. Avatar for Norrjane 49. Norrjane Lv 1 27 pts. 9,077
  10. Avatar for nemo7731 50. nemo7731 Lv 1 26 pts. 9,072

Comments