Placeholder image of a protein
Icon representing a puzzle

1175: Unsolved De-novo Freestyle 62

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DEREKMKRVWEKVEKGTHVQVELNNGQITIRVRNGREYEIRINDGGVEVDIKGNDKDEFEKVKEEIEKKV

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,641
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,582
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 7,891
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,278
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,149
  6. Avatar for CureCoin 16. CureCoin 1 pt. 6,089
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 3,057
  1. Avatar for aznarog 51. aznarog Lv 1 25 pts. 9,071
  2. Avatar for Bruno Kestemont 52. Bruno Kestemont Lv 1 24 pts. 9,062
  3. Avatar for alcor29 53. alcor29 Lv 1 23 pts. 9,058
  4. Avatar for jobo0502 54. jobo0502 Lv 1 23 pts. 9,055
  5. Avatar for Deleted player 55. Deleted player 22 pts. 9,039
  6. Avatar for gloverd 56. gloverd Lv 1 21 pts. 9,019
  7. Avatar for goastano 57. goastano Lv 1 21 pts. 9,016
  8. Avatar for guineapig 58. guineapig Lv 1 20 pts. 9,004
  9. Avatar for gdnskye 59. gdnskye Lv 1 19 pts. 9,004
  10. Avatar for hpaege 60. hpaege Lv 1 19 pts. 8,993

Comments