Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for Sydefecks 191. Sydefecks Lv 1 1 pt. 8,286
  2. Avatar for Jaco van As 192. Jaco van As Lv 1 1 pt. 8,281
  3. Avatar for pizpot 193. pizpot Lv 1 1 pt. 8,277
  4. Avatar for momadoc 194. momadoc Lv 1 1 pt. 8,268
  5. Avatar for Cerzax 195. Cerzax Lv 1 1 pt. 8,259
  6. Avatar for jeeep 196. jeeep Lv 1 1 pt. 8,258
  7. Avatar for AleXusher 197. AleXusher Lv 1 1 pt. 8,256
  8. Avatar for Simek 198. Simek Lv 1 1 pt. 8,256
  9. Avatar for soccerfan2316 199. soccerfan2316 Lv 1 1 pt. 8,251
  10. Avatar for isantheautumn 200. isantheautumn Lv 1 1 pt. 8,235

Comments