Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for bertro 21. bertro Lv 1 66 pts. 8,958
  2. Avatar for Bruno Kestemont 22. Bruno Kestemont Lv 1 64 pts. 8,956
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 63 pts. 8,956
  4. Avatar for nicobul 24. nicobul Lv 1 61 pts. 8,955
  5. Avatar for KarenCH 25. KarenCH Lv 1 60 pts. 8,953
  6. Avatar for LociOiling 26. LociOiling Lv 1 59 pts. 8,951
  7. Avatar for Timo van der Laan 27. Timo van der Laan Lv 1 57 pts. 8,950
  8. Avatar for O Seki To 28. O Seki To Lv 1 56 pts. 8,950
  9. Avatar for WarpSpeed 29. WarpSpeed Lv 1 55 pts. 8,950
  10. Avatar for grogar7 30. grogar7 Lv 1 54 pts. 8,948

Comments