Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909
  1. Avatar for hansvandenhof 61. hansvandenhof Lv 1 25 pts. 8,891
  2. Avatar for arginia 62. arginia Lv 1 24 pts. 8,885
  3. Avatar for uhuuhu 63. uhuuhu Lv 1 24 pts. 8,884
  4. Avatar for frood66 64. frood66 Lv 1 23 pts. 8,880
  5. Avatar for Jim Fraser 65. Jim Fraser Lv 1 22 pts. 8,878
  6. Avatar for Giant Berk 66. Giant Berk Lv 1 22 pts. 8,874
  7. Avatar for SKSbell 67. SKSbell Lv 1 21 pts. 8,871
  8. Avatar for JUMELLE54 68. JUMELLE54 Lv 1 21 pts. 8,871
  9. Avatar for Blipperman 69. Blipperman Lv 1 20 pts. 8,862
  10. Avatar for Merf 70. Merf Lv 1 19 pts. 8,862

Comments