Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 9,136
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,088
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,059
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,044
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,892
  6. Avatar for freefolder 16. freefolder 1 pt. 8,296
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,226
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,850
  9. Avatar for CureCoin 19. CureCoin 1 pt. 5,675

  1. Avatar for t012 101. t012 Lv 1 6 pts. 8,942
  2. Avatar for dbuske 102. dbuske Lv 1 6 pts. 8,934
  3. Avatar for Psych0Active 103. Psych0Active Lv 1 6 pts. 8,931
  4. Avatar for fishercat 104. fishercat Lv 1 5 pts. 8,928
  5. Avatar for NameChangeNeeded01 105. NameChangeNeeded01 Lv 1 5 pts. 8,918
  6. Avatar for georg137 106. georg137 Lv 1 5 pts. 8,914
  7. Avatar for cinnamonkitty 107. cinnamonkitty Lv 1 5 pts. 8,912
  8. Avatar for manu8170 108. manu8170 Lv 1 5 pts. 8,910
  9. Avatar for smholst 109. smholst Lv 1 5 pts. 8,898
  10. Avatar for harvardman 110. harvardman Lv 1 4 pts. 8,893

Comments


decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.