Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,766
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,750
  3. Avatar for Contenders 3. Contenders 56 pts. 9,666
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,616
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,558
  6. Avatar for Go Science 6. Go Science 20 pts. 9,534
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,443
  9. Avatar for Deleted group 9. Deleted group pts. 9,377
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 9,370

  1. Avatar for t012 101. t012 Lv 1 6 pts. 8,942
  2. Avatar for dbuske 102. dbuske Lv 1 6 pts. 8,934
  3. Avatar for Psych0Active 103. Psych0Active Lv 1 6 pts. 8,931
  4. Avatar for fishercat 104. fishercat Lv 1 5 pts. 8,928
  5. Avatar for NameChangeNeeded01 105. NameChangeNeeded01 Lv 1 5 pts. 8,918
  6. Avatar for georg137 106. georg137 Lv 1 5 pts. 8,914
  7. Avatar for cinnamonkitty 107. cinnamonkitty Lv 1 5 pts. 8,912
  8. Avatar for manu8170 108. manu8170 Lv 1 5 pts. 8,910
  9. Avatar for smholst 109. smholst Lv 1 5 pts. 8,898
  10. Avatar for harvardman 110. harvardman Lv 1 4 pts. 8,893

Comments


decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.