Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,766
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,750
  3. Avatar for Contenders 3. Contenders 56 pts. 9,666
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,616
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,558
  6. Avatar for Go Science 6. Go Science 20 pts. 9,534
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,443
  9. Avatar for Deleted group 9. Deleted group pts. 9,377
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 9,370
  1. Avatar for silicate123 131. silicate123 Lv 1 2 pts. 8,554
  2. Avatar for bwkittitas 132. bwkittitas Lv 1 2 pts. 8,484
  3. Avatar for SouperGenious 133. SouperGenious Lv 1 2 pts. 8,470
  4. Avatar for fiendish_ghoul 134. fiendish_ghoul Lv 1 2 pts. 8,405
  5. Avatar for mirjamvandelft 135. mirjamvandelft Lv 1 2 pts. 8,390
  6. Avatar for Aldrovanda 136. Aldrovanda Lv 1 2 pts. 8,388
  7. Avatar for mitarcher 137. mitarcher Lv 1 2 pts. 8,383
  8. Avatar for Arne Heessels 138. Arne Heessels Lv 1 2 pts. 8,382
  9. Avatar for parsnip 139. parsnip Lv 1 1 pt. 8,349
  10. Avatar for GreekCivilization 140. GreekCivilization Lv 1 1 pt. 8,338

Comments

decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.