Placeholder image of a protein
Icon representing a puzzle

1183: Unsolved De-novo Freestyle 65

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 15, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


REVEKVQKMLEKVRELLKRGQQEIRVRMDSGGVEVRVNGREFQIRVDSGNMHVDVQNGDEEVRKEFEKLLEEVKKLLEKT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,766
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,750
  3. Avatar for Contenders 3. Contenders 56 pts. 9,666
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,616
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,558
  6. Avatar for Go Science 6. Go Science 20 pts. 9,534
  7. Avatar for HMT heritage 7. HMT heritage 14 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,443
  9. Avatar for Deleted group 9. Deleted group pts. 9,377
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 9,370
  1. Avatar for LuapNor 151. LuapNor Lv 1 1 pt. 8,148
  2. Avatar for Mr. Tiger 152. Mr. Tiger Lv 1 1 pt. 8,047
  3. Avatar for martinf 153. martinf Lv 1 1 pt. 8,007
  4. Avatar for lamoille 154. lamoille Lv 1 1 pt. 7,958
  5. Avatar for sean4046 155. sean4046 Lv 1 1 pt. 7,876
  6. Avatar for Wheeler22 156. Wheeler22 Lv 1 1 pt. 7,811
  7. Avatar for momadoc 157. momadoc Lv 1 1 pt. 7,791
  8. Avatar for cherry39 158. cherry39 Lv 1 1 pt. 7,772
  9. Avatar for nagistick 159. nagistick Lv 1 1 pt. 7,721
  10. Avatar for pandapharmd 160. pandapharmd Lv 1 1 pt. 7,680

Comments

decahedron Lv 1

This isn't the fold it I remembered, it seems to be for programmers rather for scientists - any help here? , yeah i wont get it from programmers, the site used to be simple, what happened? - now it's all text - i don't do text, i do creation - please get back to me

bkoep Staff Lv 1

I'm sorry, I'm not sure what you're looking for. The Foldit website hasn't changed significantly in the past few years.

This webpage simply shows some information about a current Foldit puzzle. To play the game and participate in this puzzle, you'll need download the Foldit application from our home page, and run it locally on your home computer.