Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 4,730
  1. Avatar for gdnskye 111. gdnskye Lv 1 5 pts. 9,021
  2. Avatar for mitarcher 112. mitarcher Lv 1 5 pts. 9,009
  3. Avatar for TJOK fan 113. TJOK fan Lv 1 5 pts. 9,001
  4. Avatar for SWR_DMaster 114. SWR_DMaster Lv 1 5 pts. 8,999
  5. Avatar for tallguy-13088 115. tallguy-13088 Lv 1 5 pts. 8,992
  6. Avatar for brgreening 116. brgreening Lv 1 4 pts. 8,980
  7. Avatar for Jajaboman 117. Jajaboman Lv 1 4 pts. 8,969
  8. Avatar for Antibrad 118. Antibrad Lv 1 4 pts. 8,950
  9. Avatar for RyeSnake 119. RyeSnake Lv 1 4 pts. 8,945
  10. Avatar for JMStiffler 120. JMStiffler Lv 1 4 pts. 8,893

Comments