Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703
  1. Avatar for gdnskye 111. gdnskye Lv 1 5 pts. 9,021
  2. Avatar for mitarcher 112. mitarcher Lv 1 5 pts. 9,009
  3. Avatar for TJOK fan 113. TJOK fan Lv 1 5 pts. 9,001
  4. Avatar for SWR_DMaster 114. SWR_DMaster Lv 1 5 pts. 8,999
  5. Avatar for tallguy-13088 115. tallguy-13088 Lv 1 5 pts. 8,992
  6. Avatar for brgreening 116. brgreening Lv 1 4 pts. 8,980
  7. Avatar for Jajaboman 117. Jajaboman Lv 1 4 pts. 8,969
  8. Avatar for Antibrad 118. Antibrad Lv 1 4 pts. 8,950
  9. Avatar for RyeSnake 119. RyeSnake Lv 1 4 pts. 8,945
  10. Avatar for JMStiffler 120. JMStiffler Lv 1 4 pts. 8,893

Comments