Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Team China 21. Team China 1 pt. 4,730

  1. Avatar for pandapharmd 141. pandapharmd Lv 1 2 pts. 8,582
  2. Avatar for fryguy 142. fryguy Lv 1 2 pts. 8,568
  3. Avatar for Auntecedent 143. Auntecedent Lv 1 2 pts. 8,537
  4. Avatar for decbin 144. decbin Lv 1 2 pts. 8,526
  5. Avatar for dahast.de 145. dahast.de Lv 1 2 pts. 8,504
  6. Avatar for senor pit 146. senor pit Lv 1 2 pts. 8,490
  7. Avatar for KOLTik 147. KOLTik Lv 1 1 pt. 8,490
  8. Avatar for maria_pl 148. maria_pl Lv 1 1 pt. 8,479
  9. Avatar for DrTree 149. DrTree Lv 1 1 pt. 8,467
  10. Avatar for healyim 150. healyim Lv 1 1 pt. 8,464

Comments