Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Team China 21. Team China 1 pt. 4,730

  1. Avatar for Vinara 81. Vinara Lv 1 14 pts. 9,401
  2. Avatar for Idiotboy 82. Idiotboy Lv 1 13 pts. 9,399
  3. Avatar for Mohambone 83. Mohambone Lv 1 13 pts. 9,377
  4. Avatar for lynnai 84. lynnai Lv 1 13 pts. 9,354
  5. Avatar for cobaltteal 85. cobaltteal Lv 1 12 pts. 9,351
  6. Avatar for SKSbell 86. SKSbell Lv 1 12 pts. 9,337
  7. Avatar for bendbob 87. bendbob Lv 1 12 pts. 9,336
  8. Avatar for Mydogisa Toelicker 88. Mydogisa Toelicker Lv 1 11 pts. 9,307
  9. Avatar for Colostomy EXPLOSION. 89. Colostomy EXPLOSION. Lv 1 11 pts. 9,285
  10. Avatar for caglar 90. caglar Lv 1 10 pts. 9,269

Comments