Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703

  1. Avatar for Vinara 81. Vinara Lv 1 14 pts. 9,401
  2. Avatar for Idiotboy 82. Idiotboy Lv 1 13 pts. 9,399
  3. Avatar for Mohambone 83. Mohambone Lv 1 13 pts. 9,377
  4. Avatar for lynnai 84. lynnai Lv 1 13 pts. 9,354
  5. Avatar for cobaltteal 85. cobaltteal Lv 1 12 pts. 9,351
  6. Avatar for SKSbell 86. SKSbell Lv 1 12 pts. 9,337
  7. Avatar for bendbob 87. bendbob Lv 1 12 pts. 9,336
  8. Avatar for Mydogisa Toelicker 88. Mydogisa Toelicker Lv 1 11 pts. 9,307
  9. Avatar for Colostomy EXPLOSION. 89. Colostomy EXPLOSION. Lv 1 11 pts. 9,285
  10. Avatar for caglar 90. caglar Lv 1 10 pts. 9,269

Comments