Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for hada 121. hada Lv 1 5 pts. 8,452
  2. Avatar for justjustin 122. justjustin Lv 1 4 pts. 8,444
  3. Avatar for leehaggis 123. leehaggis Lv 1 4 pts. 8,438
  4. Avatar for pandapharmd 124. pandapharmd Lv 1 4 pts. 8,429
  5. Avatar for ManVsYard 125. ManVsYard Lv 1 4 pts. 8,421
  6. Avatar for Punktchen 126. Punktchen Lv 1 4 pts. 8,419
  7. Avatar for Amphimixus 127. Amphimixus Lv 1 4 pts. 8,414
  8. Avatar for Psych0Active 128. Psych0Active Lv 1 4 pts. 8,410
  9. Avatar for Mr_Jolty 129. Mr_Jolty Lv 1 3 pts. 8,393
  10. Avatar for TJOK fan 130. TJOK fan Lv 1 3 pts. 8,383

Comments