Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for nemo7731 31. nemo7731 Lv 1 54 pts. 8,777
  2. Avatar for sheerbliss 32. sheerbliss Lv 1 53 pts. 8,777
  3. Avatar for jermainiac 33. jermainiac Lv 1 51 pts. 8,774
  4. Avatar for Galaxie 34. Galaxie Lv 1 50 pts. 8,774
  5. Avatar for pvc78 35. pvc78 Lv 1 49 pts. 8,761
  6. Avatar for nicobul 36. nicobul Lv 1 48 pts. 8,760
  7. Avatar for gitwut 37. gitwut Lv 1 47 pts. 8,758
  8. Avatar for goastano 38. goastano Lv 1 46 pts. 8,756
  9. Avatar for Deleted player 39. Deleted player 45 pts. 8,753
  10. Avatar for Norrjane 40. Norrjane Lv 1 44 pts. 8,750

Comments