Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 8,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 8,923
  3. Avatar for Contenders 3. Contenders 65 pts. 8,915
  4. Avatar for Go Science 4. Go Science 52 pts. 8,913
  5. Avatar for Void Crushers 5. Void Crushers 41 pts. 8,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 32 pts. 8,877
  7. Avatar for Gargleblasters 7. Gargleblasters 24 pts. 8,852
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,742
  9. Avatar for Deleted group 9. Deleted group pts. 8,721
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 10 pts. 8,662
  1. Avatar for RyeSnake 91. RyeSnake Lv 1 12 pts. 8,569
  2. Avatar for PrettyPony2001 92. PrettyPony2001 Lv 1 11 pts. 8,569
  3. Avatar for bx7gn 93. bx7gn Lv 1 11 pts. 8,565
  4. Avatar for dbuske 94. dbuske Lv 1 11 pts. 8,559
  5. Avatar for Vinara 95. Vinara Lv 1 10 pts. 8,558
  6. Avatar for uihcv 96. uihcv Lv 1 10 pts. 8,556
  7. Avatar for kitek314_pl 97. kitek314_pl Lv 1 10 pts. 8,547
  8. Avatar for zo3xiaJonWeinberg 98. zo3xiaJonWeinberg Lv 1 9 pts. 8,543
  9. Avatar for DrTree 99. DrTree Lv 1 9 pts. 8,541
  10. Avatar for ecali 100. ecali Lv 1 9 pts. 8,532

Comments