Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0

  1. Avatar for kitek314_pl 111. kitek314_pl Lv 1 5 pts. 8,329
  2. Avatar for Auntecedent 112. Auntecedent Lv 1 5 pts. 8,308
  3. Avatar for MaartenDesnouck 113. MaartenDesnouck Lv 1 4 pts. 8,300
  4. Avatar for BackBuffer 114. BackBuffer Lv 1 4 pts. 8,300
  5. Avatar for hallenberg 115. hallenberg Lv 1 4 pts. 8,292
  6. Avatar for GreekCivilization 116. GreekCivilization Lv 1 4 pts. 8,286
  7. Avatar for TJOK fan 117. TJOK fan Lv 1 4 pts. 8,285
  8. Avatar for fiendish_ghoul 118. fiendish_ghoul Lv 1 4 pts. 8,274
  9. Avatar for Psych0Active 119. Psych0Active Lv 1 4 pts. 8,252
  10. Avatar for Cyberkashi 120. Cyberkashi Lv 1 3 pts. 8,243

Comments