Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776
  1. Avatar for kitek314_pl 111. kitek314_pl Lv 1 5 pts. 8,329
  2. Avatar for Auntecedent 112. Auntecedent Lv 1 5 pts. 8,308
  3. Avatar for MaartenDesnouck 113. MaartenDesnouck Lv 1 4 pts. 8,300
  4. Avatar for BackBuffer 114. BackBuffer Lv 1 4 pts. 8,300
  5. Avatar for hallenberg 115. hallenberg Lv 1 4 pts. 8,292
  6. Avatar for GreekCivilization 116. GreekCivilization Lv 1 4 pts. 8,286
  7. Avatar for TJOK fan 117. TJOK fan Lv 1 4 pts. 8,285
  8. Avatar for fiendish_ghoul 118. fiendish_ghoul Lv 1 4 pts. 8,274
  9. Avatar for Psych0Active 119. Psych0Active Lv 1 4 pts. 8,252
  10. Avatar for Cyberkashi 120. Cyberkashi Lv 1 3 pts. 8,243

Comments