Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for Susume 11. Susume Lv 1 81 pts. 9,025
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 79 pts. 9,008
  3. Avatar for gitwut 13. gitwut Lv 1 77 pts. 9,000
  4. Avatar for frood66 14. frood66 Lv 1 76 pts. 8,984
  5. Avatar for Galaxie 15. Galaxie Lv 1 74 pts. 8,977
  6. Avatar for LociOiling 16. LociOiling Lv 1 72 pts. 8,974
  7. Avatar for KarenCH 17. KarenCH Lv 1 71 pts. 8,967
  8. Avatar for gmn 18. gmn Lv 1 69 pts. 8,966
  9. Avatar for reefyrob 19. reefyrob Lv 1 68 pts. 8,964
  10. Avatar for MurloW 20. MurloW Lv 1 66 pts. 8,963

Comments