Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776
  1. Avatar for Susume 11. Susume Lv 1 81 pts. 9,025
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 79 pts. 9,008
  3. Avatar for gitwut 13. gitwut Lv 1 77 pts. 9,000
  4. Avatar for frood66 14. frood66 Lv 1 76 pts. 8,984
  5. Avatar for Galaxie 15. Galaxie Lv 1 74 pts. 8,977
  6. Avatar for LociOiling 16. LociOiling Lv 1 72 pts. 8,974
  7. Avatar for KarenCH 17. KarenCH Lv 1 71 pts. 8,967
  8. Avatar for gmn 18. gmn Lv 1 69 pts. 8,966
  9. Avatar for reefyrob 19. reefyrob Lv 1 68 pts. 8,964
  10. Avatar for MurloW 20. MurloW Lv 1 66 pts. 8,963

Comments