Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for Deleted player 31. Deleted player pts. 8,907
  2. Avatar for shettler 32. shettler Lv 1 50 pts. 8,906
  3. Avatar for nicobul 33. nicobul Lv 1 49 pts. 8,901
  4. Avatar for gurch 34. gurch Lv 1 47 pts. 8,892
  5. Avatar for nemo7731 35. nemo7731 Lv 1 46 pts. 8,892
  6. Avatar for jermainiac 36. jermainiac Lv 1 45 pts. 8,891
  7. Avatar for pauldunn 37. pauldunn Lv 1 44 pts. 8,889
  8. Avatar for grogar7 38. grogar7 Lv 1 43 pts. 8,877
  9. Avatar for Museka 39. Museka Lv 1 42 pts. 8,876
  10. Avatar for jobo0502 40. jobo0502 Lv 1 41 pts. 8,872

Comments