Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776
  1. Avatar for Deleted player 31. Deleted player pts. 8,907
  2. Avatar for shettler 32. shettler Lv 1 50 pts. 8,906
  3. Avatar for nicobul 33. nicobul Lv 1 49 pts. 8,901
  4. Avatar for gurch 34. gurch Lv 1 47 pts. 8,892
  5. Avatar for nemo7731 35. nemo7731 Lv 1 46 pts. 8,892
  6. Avatar for jermainiac 36. jermainiac Lv 1 45 pts. 8,891
  7. Avatar for pauldunn 37. pauldunn Lv 1 44 pts. 8,889
  8. Avatar for grogar7 38. grogar7 Lv 1 43 pts. 8,877
  9. Avatar for Museka 39. Museka Lv 1 42 pts. 8,876
  10. Avatar for jobo0502 40. jobo0502 Lv 1 41 pts. 8,872

Comments