Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for deLaCeiba 51. deLaCeiba Lv 1 31 pts. 8,776
  2. Avatar for tarimo 52. tarimo Lv 1 30 pts. 8,768
  3. Avatar for pvc78 53. pvc78 Lv 1 29 pts. 8,751
  4. Avatar for manu8170 54. manu8170 Lv 1 28 pts. 8,746
  5. Avatar for YGK 55. YGK Lv 1 28 pts. 8,726
  6. Avatar for andrewxc 56. andrewxc Lv 1 27 pts. 8,715
  7. Avatar for justjustin 57. justjustin Lv 1 26 pts. 8,709
  8. Avatar for Vinara 58. Vinara Lv 1 25 pts. 8,696
  9. Avatar for Satina 59. Satina Lv 1 25 pts. 8,692
  10. Avatar for cinnamonkitty 60. cinnamonkitty Lv 1 24 pts. 8,681

Comments