Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776
  1. Avatar for Vredeman 81. Vredeman Lv 1 13 pts. 8,542
  2. Avatar for georg137 82. georg137 Lv 1 13 pts. 8,542
  3. Avatar for stomjoh 83. stomjoh Lv 1 12 pts. 8,532
  4. Avatar for guineapig 84. guineapig Lv 1 12 pts. 8,524
  5. Avatar for tallguy-13088 85. tallguy-13088 Lv 1 11 pts. 8,516
  6. Avatar for Soggy Doglog 86. Soggy Doglog Lv 1 11 pts. 8,501
  7. Avatar for diamonddays 87. diamonddays Lv 1 11 pts. 8,495
  8. Avatar for Deleted player 88. Deleted player pts. 8,486
  9. Avatar for weitzen 89. weitzen Lv 1 10 pts. 8,475
  10. Avatar for Pro Lapser 90. Pro Lapser Lv 1 10 pts. 8,471

Comments