Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for xkcd 11. xkcd 4 pts. 8,902
  2. Avatar for freefolder 12. freefolder 3 pts. 8,883
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,554
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,494
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,388
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,329
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,252
  8. Avatar for Russian team 18. Russian team 1 pt. 8,033
  9. Avatar for Deleted group 19. Deleted group pts. 7,955
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,312
  1. Avatar for Graham MF 111. Graham MF Lv 1 4 pts. 8,648
  2. Avatar for froggs554 112. froggs554 Lv 1 4 pts. 8,644
  3. Avatar for zo3xiaJonWeinberg 113. zo3xiaJonWeinberg Lv 1 3 pts. 8,639
  4. Avatar for hada 114. hada Lv 1 3 pts. 8,639
  5. Avatar for uihcv 115. uihcv Lv 1 3 pts. 8,638
  6. Avatar for Giant Berk 116. Giant Berk Lv 1 3 pts. 8,616
  7. Avatar for nagistick 117. nagistick Lv 1 3 pts. 8,604
  8. Avatar for Mike Lewis 118. Mike Lewis Lv 1 3 pts. 8,568
  9. Avatar for Jajaboman 119. Jajaboman Lv 1 3 pts. 8,554
  10. Avatar for smholst 120. smholst Lv 1 3 pts. 8,530

Comments