Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for xkcd 11. xkcd 4 pts. 8,902
  2. Avatar for freefolder 12. freefolder 3 pts. 8,883
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,554
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,494
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,388
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,329
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,252
  8. Avatar for Russian team 18. Russian team 1 pt. 8,033
  9. Avatar for Deleted group 19. Deleted group pts. 7,955
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,312

  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 38 pts. 9,268
  2. Avatar for joremen 42. joremen Lv 1 37 pts. 9,268
  3. Avatar for Glen B 43. Glen B Lv 1 36 pts. 9,249
  4. Avatar for frood66 44. frood66 Lv 1 35 pts. 9,242
  5. Avatar for pvc78 45. pvc78 Lv 1 34 pts. 9,231
  6. Avatar for christioanchauvin 46. christioanchauvin Lv 1 33 pts. 9,216
  7. Avatar for phi16 47. phi16 Lv 1 32 pts. 9,215
  8. Avatar for pmdpmd 48. pmdpmd Lv 1 31 pts. 9,213
  9. Avatar for grogar7 49. grogar7 Lv 1 30 pts. 9,208
  10. Avatar for shettler 50. shettler Lv 1 29 pts. 9,199

Comments