Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 38 pts. 9,268
  2. Avatar for joremen 42. joremen Lv 1 37 pts. 9,268
  3. Avatar for Glen B 43. Glen B Lv 1 36 pts. 9,249
  4. Avatar for frood66 44. frood66 Lv 1 35 pts. 9,242
  5. Avatar for pvc78 45. pvc78 Lv 1 34 pts. 9,231
  6. Avatar for christioanchauvin 46. christioanchauvin Lv 1 33 pts. 9,216
  7. Avatar for phi16 47. phi16 Lv 1 32 pts. 9,215
  8. Avatar for pmdpmd 48. pmdpmd Lv 1 31 pts. 9,213
  9. Avatar for grogar7 49. grogar7 Lv 1 30 pts. 9,208
  10. Avatar for shettler 50. shettler Lv 1 29 pts. 9,199

Comments