Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 38 pts. 9,268
  2. Avatar for joremen 42. joremen Lv 1 37 pts. 9,268
  3. Avatar for Glen B 43. Glen B Lv 1 36 pts. 9,249
  4. Avatar for frood66 44. frood66 Lv 1 35 pts. 9,242
  5. Avatar for pvc78 45. pvc78 Lv 1 34 pts. 9,231
  6. Avatar for christioanchauvin 46. christioanchauvin Lv 1 33 pts. 9,216
  7. Avatar for phi16 47. phi16 Lv 1 32 pts. 9,215
  8. Avatar for pmdpmd 48. pmdpmd Lv 1 31 pts. 9,213
  9. Avatar for grogar7 49. grogar7 Lv 1 30 pts. 9,208
  10. Avatar for shettler 50. shettler Lv 1 29 pts. 9,199

Comments