Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 28 pts. 9,189
  2. Avatar for tarimo 52. tarimo Lv 1 28 pts. 9,176
  3. Avatar for gurch 53. gurch Lv 1 27 pts. 9,172
  4. Avatar for g_b 54. g_b Lv 1 26 pts. 9,170
  5. Avatar for isaksson 55. isaksson Lv 1 25 pts. 9,158
  6. Avatar for fiendish_ghoul 56. fiendish_ghoul Lv 1 25 pts. 9,155
  7. Avatar for smilingone 57. smilingone Lv 1 24 pts. 9,155
  8. Avatar for adelelopez 58. adelelopez Lv 1 23 pts. 9,153
  9. Avatar for andrewxc 59. andrewxc Lv 1 23 pts. 9,125
  10. Avatar for lynnai 60. lynnai Lv 1 22 pts. 9,120

Comments