Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060
  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 28 pts. 9,189
  2. Avatar for tarimo 52. tarimo Lv 1 28 pts. 9,176
  3. Avatar for gurch 53. gurch Lv 1 27 pts. 9,172
  4. Avatar for g_b 54. g_b Lv 1 26 pts. 9,170
  5. Avatar for isaksson 55. isaksson Lv 1 25 pts. 9,158
  6. Avatar for fiendish_ghoul 56. fiendish_ghoul Lv 1 25 pts. 9,155
  7. Avatar for smilingone 57. smilingone Lv 1 24 pts. 9,155
  8. Avatar for adelelopez 58. adelelopez Lv 1 23 pts. 9,153
  9. Avatar for andrewxc 59. andrewxc Lv 1 23 pts. 9,125
  10. Avatar for lynnai 60. lynnai Lv 1 22 pts. 9,120

Comments