Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 6,985

  1. Avatar for cbwest 61. cbwest Lv 1 21 pts. 9,120
  2. Avatar for steveB 62. steveB Lv 1 21 pts. 9,111
  3. Avatar for jamiexq 63. jamiexq Lv 1 20 pts. 9,088
  4. Avatar for crpainter 64. crpainter Lv 1 19 pts. 9,072
  5. Avatar for Satina 65. Satina Lv 1 19 pts. 9,062
  6. Avatar for deLaCeiba 66. deLaCeiba Lv 1 18 pts. 9,060
  7. Avatar for drumpeter18yrs9yrs 67. drumpeter18yrs9yrs Lv 1 18 pts. 9,058
  8. Avatar for jobo0502 68. jobo0502 Lv 1 17 pts. 9,050
  9. Avatar for caglar 69. caglar Lv 1 17 pts. 9,005
  10. Avatar for goastano 70. goastano Lv 1 16 pts. 8,985

Comments