Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060
  1. Avatar for cbwest 61. cbwest Lv 1 21 pts. 9,120
  2. Avatar for steveB 62. steveB Lv 1 21 pts. 9,111
  3. Avatar for jamiexq 63. jamiexq Lv 1 20 pts. 9,088
  4. Avatar for crpainter 64. crpainter Lv 1 19 pts. 9,072
  5. Avatar for Satina 65. Satina Lv 1 19 pts. 9,062
  6. Avatar for deLaCeiba 66. deLaCeiba Lv 1 18 pts. 9,060
  7. Avatar for drumpeter18yrs9yrs 67. drumpeter18yrs9yrs Lv 1 18 pts. 9,058
  8. Avatar for jobo0502 68. jobo0502 Lv 1 17 pts. 9,050
  9. Avatar for caglar 69. caglar Lv 1 17 pts. 9,005
  10. Avatar for goastano 70. goastano Lv 1 16 pts. 8,985

Comments