Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for cinnamonkitty 101. cinnamonkitty Lv 1 6 pts. 8,702
  2. Avatar for SouperGenious 102. SouperGenious Lv 1 5 pts. 8,701
  3. Avatar for alcor29 103. alcor29 Lv 1 5 pts. 8,688
  4. Avatar for JUMELLE54 104. JUMELLE54 Lv 1 5 pts. 8,686
  5. Avatar for Festering Wounds 105. Festering Wounds Lv 1 5 pts. 8,683
  6. Avatar for cbwest 106. cbwest Lv 1 5 pts. 8,674
  7. Avatar for Bushman 107. Bushman Lv 1 4 pts. 8,673
  8. Avatar for Iron pet 108. Iron pet Lv 1 4 pts. 8,660
  9. Avatar for arginia 109. arginia Lv 1 4 pts. 8,643
  10. Avatar for Giant Berk 110. Giant Berk Lv 1 4 pts. 8,642

Comments