Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for cinnamonkitty 101. cinnamonkitty Lv 1 6 pts. 8,702
  2. Avatar for SouperGenious 102. SouperGenious Lv 1 5 pts. 8,701
  3. Avatar for alcor29 103. alcor29 Lv 1 5 pts. 8,688
  4. Avatar for JUMELLE54 104. JUMELLE54 Lv 1 5 pts. 8,686
  5. Avatar for Festering Wounds 105. Festering Wounds Lv 1 5 pts. 8,683
  6. Avatar for cbwest 106. cbwest Lv 1 5 pts. 8,674
  7. Avatar for Bushman 107. Bushman Lv 1 4 pts. 8,673
  8. Avatar for Iron pet 108. Iron pet Lv 1 4 pts. 8,660
  9. Avatar for arginia 109. arginia Lv 1 4 pts. 8,643
  10. Avatar for Giant Berk 110. Giant Berk Lv 1 4 pts. 8,642

Comments