Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for BCAA 111. BCAA Lv 1 4 pts. 8,637
  2. Avatar for Soggy Doglog 112. Soggy Doglog Lv 1 4 pts. 8,632
  3. Avatar for Punktchen 113. Punktchen Lv 1 4 pts. 8,619
  4. Avatar for Jaco van As 114. Jaco van As Lv 1 3 pts. 8,615
  5. Avatar for Ernst Zundel 115. Ernst Zundel Lv 1 3 pts. 8,599
  6. Avatar for ratqueen03 116. ratqueen03 Lv 1 3 pts. 8,583
  7. Avatar for tela 117. tela Lv 1 3 pts. 8,581
  8. Avatar for tallguy-13088 118. tallguy-13088 Lv 1 3 pts. 8,576
  9. Avatar for uihcv 119. uihcv Lv 1 3 pts. 8,569
  10. Avatar for TheStaticSloth 120. TheStaticSloth Lv 1 3 pts. 8,552

Comments