Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups


  1. Avatar for Go Science 100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899

  1. Avatar for BCAA 111. BCAA Lv 1 4 pts. 8,637
  2. Avatar for Soggy Doglog 112. Soggy Doglog Lv 1 4 pts. 8,632
  3. Avatar for Punktchen 113. Punktchen Lv 1 4 pts. 8,619
  4. Avatar for Jaco van As 114. Jaco van As Lv 1 3 pts. 8,615
  5. Avatar for Ernst Zundel 115. Ernst Zundel Lv 1 3 pts. 8,599
  6. Avatar for ratqueen03 116. ratqueen03 Lv 1 3 pts. 8,583
  7. Avatar for tela 117. tela Lv 1 3 pts. 8,581
  8. Avatar for tallguy-13088 118. tallguy-13088 Lv 1 3 pts. 8,576
  9. Avatar for uihcv 119. uihcv Lv 1 3 pts. 8,569
  10. Avatar for TheStaticSloth 120. TheStaticSloth Lv 1 3 pts. 8,552

Comments